[Arg6]-β-Amyloid (1-42), england mutation

CAS: F: C203H316N56O60S W: 4533.09

-β-Amyloid (1-42), england mutation is a biological active peptide. (Several mutations in the beta amyloid precursor ge

Contact QiTai

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity	[Arg6]-β-Amyloid (1-42), england mutation is a biological active peptide. (Several mutations in the beta amyloid precursor gene cause autosomal dominant Alzheimer's Disease in a number of kindreds.Tthe English (H6R) mutation will disrupt H6 interactions.)
Name	[Arg6]-β-Amyloid (1-42), england mutation
Sequence	Asp-Ala-Glu-Phe-Arg-Arg-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala
Shortening	DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Formula	C203H316N56O60S
Molar Mass	4533.09
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.

[Asn23] β-Amyloid (1-40), Iowa mutation

[Lys3]-Bombesin